General information
| PDB ID | 5XBD |
|---|---|
| Chain ID | A |
| Length | 36 |
| Peptide type | Non-natural |
| Complex | Monomeric |
| Peptide name | PB1 |
| Source organism | Vaccaria Hispanica |
| Experimental method | SOLUTION NMR |
| Release | 2018-02-14 |
Sequence & modifications
| Sequence | QCKPNGAKCTEISIPPCCSNFCLRYAGQKSGTCANR |
|---|---|
| Nonstandard residue | PCA |
| Modified sequence | (PCA)CKPNGAKCTEISIPPCCSNFCLRYAGQKSGTCANR |
Structure information
| Disulfide number | 3 |
|---|---|
| Disulfide position | A:2-A:18, A:9-A:22, A:17-A:33 |
| Cyclization type | SS |
| Structure feature | Coil |
| Ring number | 3 |
3D visualization
Drag to rotate • Scroll to zoom • Right-drag to pan • Hover/click to inspect
Failed to load structure from RCSB. Please check network / PDB ID.
Literature information
- PubMed: 29312404
- DOI: 10.3389/FPLS.2017.02162
Downloads & links