General information
| PDB ID | 5LCS |
|---|---|
| Chain ID | A |
| Length | 47 |
| Peptide type | Non-natural |
| Complex | Monomeric |
| Peptide name | GALLINACIN-7 |
| Source organism | Gallus Gallus |
| Experimental method | SOLUTION NMR |
| Release | 2016-09-07 |
Sequence & modifications
| Sequence | QPFIPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCARGWRS |
|---|---|
| Nonstandard residue | PCA |
| Modified sequence | (PCA)PFIPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCARGWRS |
Structure information
| Disulfide number | 3 |
|---|---|
| Disulfide position | A:11-A:40, A:18-A:33, A:23-A:41 |
| Cyclization type | SS |
| Structure feature | Beta-sheet |
| Ring number | 3 |
3D visualization
Drag to rotate • Scroll to zoom • Right-drag to pan • Hover/click to inspect
Failed to load structure from RCSB. Please check network / PDB ID.
Literature information
- PubMed: 27561012
- DOI: 10.1371/JOURNAL.PONE.0161573
Downloads & links