General information
| PDB ID | 2N3P |
|---|---|
| Chain ID | A |
| Length | 32 |
| Peptide type | Non-natural |
| Complex | Monomeric |
| Peptide name | ASTEROPSIN_G |
| Source organism | Asteropus |
| Experimental method | SOLUTION NMR |
| Release | 2016-06-08 |
Sequence & modifications
| Sequence | QWCAEEGESCEVYPCCDGLICYPTFPEPICGV |
|---|---|
| Nonstandard residue | PCA |
| Modified sequence | (PCA)WCAEEGESCEVYPCCDGLICYPTFPEPICGV |
Structure information
| Disulfide number | 3 |
|---|---|
| Disulfide position | A:3-A:16, A:10-A:21, A:15-A:30 |
| Cyclization type | SS |
| Structure feature | Beta-sheet |
| Ring number | 3 |
3D visualization
Drag to rotate • Scroll to zoom • Right-drag to pan • Hover/click to inspect
Failed to load structure from RCSB. Please check network / PDB ID.
Literature information
- PubMed: -
- DOI: -
Downloads & links