General information
| PDB ID | 2K9E |
|---|---|
| Chain ID | A |
| Length | 38 |
| Peptide type | Non-natural |
| Complex | Monomeric |
| Peptide name | KAPPA-STICHOTOXIN-SHE3A |
| Source organism | Stichodactyla Helianthus |
| Experimental method | SOLUTION NMR |
| Release | 2009-01-20 |
Sequence & modifications
| Sequence | FXRSCIDTIPKSRCTAFQCKHSLKYRLSFCRKTCGTCX |
|---|---|
| Nonstandard residue | ZV4,PFX,NLE |
| Modified sequence | (ZV4)(PFX)RSCIDTIPKSRCTAFQCKHS(NLE)KYRLSFCRKTCGTC(NH2) |
Structure information
| Disulfide number | 3 |
|---|---|
| Disulfide position | A:3-A:35, A:12-A:28, A:17-A:32 |
| Cyclization type | SS |
| Structure feature | Alpha-helix |
| Ring number | 3 |
3D visualization
Drag to rotate • Scroll to zoom • Right-drag to pan • Hover/click to inspect
Failed to load structure from RCSB. Please check network / PDB ID.
Literature information
- PubMed: 19122005
- DOI: 10.1124/MOL.108.052704
Downloads & links