General information
| PDB ID | 1S8K |
|---|---|
| Chain ID | A |
| Length | 31 |
| Peptide type | Non-natural |
| Complex | Monomeric |
| Peptide name | TOXIN BMKK4 |
| Source organism | Mesobuthus Martensii |
| Experimental method | SOLUTION NMR |
| Release | 2005-02-08 |
Sequence & modifications
| Sequence | QTQCQSVRDCQQYCLTPDRCSYGTCYCKTTX |
|---|---|
| Nonstandard residue | PCA |
| Modified sequence | (PCA)TQCQSVRDCQQYCLTPDRCSYGTCYCKTT(NH2) |
Structure information
| Disulfide number | 3 |
|---|---|
| Disulfide position | A:4-A:20, A:10-A:25, A:14-A:27 |
| Cyclization type | SS |
| Structure feature | Mixed |
| Ring number | 3 |
3D visualization
Drag to rotate • Scroll to zoom • Right-drag to pan • Hover/click to inspect
Failed to load structure from RCSB. Please check network / PDB ID.
Literature information
- PubMed: 15449936
- DOI: 10.1021/BI0490643
Downloads & links