General information
| PDB ID | 1BAH |
|---|---|
| Chain ID | A |
| Length | 37 |
| Peptide type | Non-natural |
| Complex | Monomeric |
| Peptide name | CHARYBDOTOXIN |
| Source organism | Leiurus Quinquestriatus |
| Experimental method | SOLUTION NMR |
| Release | 1997-01-11 |
Sequence & modifications
| Sequence | QFTNVSCTTSKEAWSVCQRLHNTSRGKCMNKKARCYS |
|---|---|
| Nonstandard residue | PCA,ABA |
| Modified sequence | (PCA)FTNVSCTTSKE(ABA)WSVCQRLHNTSRGKCMNKK(ABA)RCYS |
Structure information
| Disulfide number | 2 |
|---|---|
| Disulfide position | A:7-A:28, A:17-A:35 |
| Cyclization type | SS |
| Structure feature | Coil |
| Ring number | 2 |
3D visualization
Drag to rotate • Scroll to zoom • Right-drag to pan • Hover/click to inspect
Failed to load structure from RCSB. Please check network / PDB ID.
Literature information
- PubMed: 9092804
- DOI: 10.1021/BI962720H
Downloads & links