General information
| PDB ID | 2CRD |
|---|---|
| Chain ID | A |
| Length | 37 |
| Peptide type | Non-natural |
| Complex | Monomeric |
| Peptide name | CHARYBDOTOXIN |
| Source organism | Leiurus Quinquestriatus Hebraeus |
| Experimental method | SOLUTION NMR |
| Release | 1993-07-15 |
Sequence & modifications
| Sequence | QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS |
|---|---|
| Nonstandard residue | PCA |
| Modified sequence | (PCA)FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS |
Structure information
| Disulfide number | 3 |
|---|---|
| Disulfide position | A:7-A:28, A:13-A:33, A:17-A:35 |
| Cyclization type | SS |
| Structure feature | Mixed |
| Ring number | 3 |
3D visualization
Drag to rotate • Scroll to zoom • Right-drag to pan • Hover/click to inspect
Failed to load structure from RCSB. Please check network / PDB ID.
Literature information
- PubMed: 1380828
- DOI: 10.1021/BI00149A003
Downloads & links